ImageImage
ImageImage
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact

Curry Shrimp With Snap Peas

Don’t know what to cook?  I have a quick and delicious meal just for you. Cook right along with me in my kitchen today! Curry Shrimp and Snap peas are on the menu. Everything you need to know about this recipe is posted below. Ingredients: 2 Tbs. Organic Coconut Oil 2 Tbs. Curry Powder 1-2 Dozen Shrimp (peeled and deveined) …

Read More
budgetfriendlymealscurryrecipescurryshrimpfitnessmealshealthydinnerhealthymealsquickmealsshrimpweeknightdinner

Taylor Walker

The Enlite Bra: HIIT Tested. Taylor Approved.

Taylor is a Certified Personal Trainer, Barre Instructor, Spartan SGX and Nutrition Coach. Taylor has been featured in ads for major brands such as: Nike, Under Armour, FILA, Champion USA, Belk, Beall's, Kohl's, Atlantis Resort, Babies "R" Us, Zappos & more! You can find her gracing the pages of Fitness, Shape and Women's Health Magazine.

Subscribe

Follow me on Pinterest!

@TaylorWalkerFit

Instagram did not return a 200.

Follow Me!

What’s one #perimenopause symptom you were not exp What’s one #perimenopause symptom you were not expecting? Lack of motivation came out of nowhere,  but I’m tackling it head on and sharing everything along the way. Talk to me below…has anything surprised you? #TEAMTWF
Strawberry Bliss: Energy Bites This summer snack Strawberry Bliss: Energy Bites 

This summer snack will not disappoint! I have to say, this is one of my favorite ways to use freeze dried fruit. Comment ‘BERRY’ and I’ll send the recipe right to your inbox. #twfeats
RV Life is so much fun! It’s a way to connect, enj RV Life is so much fun! It’s a way to connect, enjoy nature and throw it back to a different time. 

Comment RV below and I will send all the deets on how to book, what to bring and how to choose the right campsite for you! 

#RVlife #RVrental #FamilyCamping #CampingWithKids #RVtravel FamilyAdventures CampLife OutdoorFamily RVtrip MakeMemories
Putting in the work with @nowfoodsofficial gaining Putting in the work with @nowfoodsofficial gaining Central Park miles followed by recovery conversations, smoothies, and time with some amazing people. #AD

Loved learning more about the role recovery plays in performance—and why what you do after the workout matters just as much as the workout itself. Excited that two of @nowfoodsofficial’s science-backed sports supplements - R&R Rest & Repair and Advanced Joint Support – are now available at @vitaminshoppe nationwide. 

Thanks @nowfoodsofficial and @vitaminshoppe for such a fun morning.  #NowPartner #NOWSports #NOWWellness #VitaminShoppe
SEVEN was not the age I thought this conversation SEVEN was not the age I thought this conversation would happen, but here we are. I knew this day would happen. I always said to my husband, this will likely happen more to them because they’re white passing, but that doesn’t change the fact that they are black .

This Friday is Juneteenth. An American holiday commemorating the effective end of slavery in the United States. My family becoming is living proof of the impossible becoming possible. 

If your family doesn’t look like mine, I urge you to raise awareness in your home. 

Read a book about our history, discuss your own lived experience with race and/or form an action plan. 

What to do if you or they hear this language. 

Conversations matter. 

I’m curious, has anything like this happened to you or how are you including conversations about race in your home?
What’s the most radical thing you have ever found What’s the most radical thing you have ever found in your bag? #AD

Spring cleaning is in full effect over here and nothing is safe!  Good thing I found @powercrunch Protein Energy Bars to get me through. 

Four Bars, Four delish flavors. A protein snack that feels like a treat. PERFECT for spring.
@nyknicks Thank you for this JOY! Would love to kn @nyknicks Thank you for this JOY! Would love to know your thoughts below. #TeamTWF
#AD POV: You have a work trip and no toddler wakin #AD POV: You have a work trip and no toddler waking you in the middle of the night. A good night’s rest is my only priority! 

As a mom constantly juggling ALL the things, sleep has become part of my priority — not just something I “hope” happens. Lately I’ve been adding Natrol® Fast Dissolve Ultra Sleep into my evening, and it’s been the easiest little wind-down moment.

It’s drug free and designed to help support better sleep quality with melatonin, GABA + dream botanicals. 

Because a better tomorrow starts the night before  @NatrolOfficial @Target #TargetPartner #Natrol #UltraSleep UltraEnergy @Shop.Ltk ltkit

LTKdayinmylife

Comment SHOP below to receive a DM with the link to this post on my LTK ⬇ https://liketk.it/6fsYt
First of all: I do wholeheartedly understand the p First of all: I do wholeheartedly understand the privilege of getting to make this decision. 

With that said, it was NOT an easy one. Parenting today is so different than it was back when we were born 

I’m curious….how did you know your family was complete? #teamtwf
Clean beauty has come SO far since I started my bl Clean beauty has come SO far since I started my blog. 

What used to be chalky and hard to shade match has become glowy perfection from day to night. 

Comment ‘Clean’ and I’ll send the link to all my clean beauty favs shown here! #cleanbeauty #over40 #cleanmakeup
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Newsletter form goes here
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Sign up for our newsletter and get...

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle.
Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle. Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

ALL RIGHTS RESERVED TWF 2026 | DESIGNED BY PAPER+SCREEN
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact