ImageImage
ImageImage
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact

Curry Shrimp With Snap Peas

Don’t know what to cook?  I have a quick and delicious meal just for you. Cook right along with me in my kitchen today! Curry Shrimp and Snap peas are on the menu. Everything you need to know about this recipe is posted below. Ingredients: 2 Tbs. Organic Coconut Oil 2 Tbs. Curry Powder 1-2 Dozen Shrimp (peeled and deveined) …

Read More
budgetfriendlymealscurryrecipescurryshrimpfitnessmealshealthydinnerhealthymealsquickmealsshrimpweeknightdinner

Taylor Walker

The Enlite Bra: HIIT Tested. Taylor Approved.

Taylor is a Certified Personal Trainer, Barre Instructor, Spartan SGX and Nutrition Coach. Taylor has been featured in ads for major brands such as: Nike, Under Armour, FILA, Champion USA, Belk, Beall's, Kohl's, Atlantis Resort, Babies "R" Us, Zappos & more! You can find her gracing the pages of Fitness, Shape and Women's Health Magazine.

Subscribe

Follow me on Pinterest!

@TaylorWalkerFit

Instagram did not return a 200.

Follow Me!

Mentally I’m already at the thing, so therefore I Mentally I’m already at the thing, so therefore I am physically useless. 😂 Anyone else?
#AD Busy days don’t need complicated routines. My #AD Busy days don’t need complicated routines.

My non-negotiables stay the same:
• protein + fiber to start the day
• make my water functional
• be prepared with easy fuel

That’s it. That’s the system. Find @Target @just.ingredients  at #target today! 

#JustIngredients #JIApproved #JIxTarget TargetPartner @just.ingredients.shop

Comment SHOP below to receive a DM with the link to this post on my LTK ⬇ https://liketk.it/60Fbn ltkmomlife ltkactive
Sustainably STRONG starts TODAY! If you want a f Sustainably STRONG starts TODAY! 

If you want a free workout at 9 AM EST join us! Comment ‘challenge’ for details. 

If you join this challenge you’ll get:

12 Weeks of Programming
Community
Live workouts and more!
A workout a day keeps the doctor away! My next cha A workout a day keeps the doctor away! My next challenge is going to be 12-weeks.  We start Monday. Comment ‘challenge’ and I’ll send you the link. 

12 Weeks of programming 
Live workouts
Community chat 
Accountability partners to get you ready for spring! 

#TeamTWF
My first six week challenge was a dream! Helping w My first six week challenge was a dream! Helping women find strength from home in 30-minutes or less. This was my own 6-week transformation and I can’t wait for yours! 

Next Up: 12 Weeks of Progressive Strength Training, Live workouts, community and more! 

Comment ‘challenge’ below and I’ll send you the details!
Want a Springtime treat that is 5-ingredients and Want a Springtime treat that is 5-ingredients and far better than anything you’ll buy in the store? Comment ‘EGG’ below and I’ll send the recipe right to your inbox! #twfeats
@thebrightwoodskin NEVER disappoints! Comment ‘Las @thebrightwoodskin NEVER disappoints! Comment ‘Laser’ below and I’ll send you the link to book your first treatment. Use the code ‘TAYLOR15’ for a discount on your first or new treatment.
#AD Fueled, moving, and keeping it simple. I grab #AD Fueled, moving, and keeping it simple.

I grabbed the Premier Protein Almondmilk Non-Dairy Protein Shakes in Chocolate, Vanilla, and Coffee and put them to work before this quick circuit.

Each shake delivers 20g of non-dairy protein made with real almonds, and they honestly taste better and feel creamier—with a rich flavor and smooth texture that fits right into busy days.

The Workout (save this):

40 sec work / 20 sec rest • 4 rounds

Chair Squat
Push-Ups
Lunge → Knee Drive
Plank Jacks
Chair Squat Pulses

Simple moves. Real effort. Fuel that shows up when you do.

Shop now at @Target. @premierprotein 
#PremierAlmondmilkProteinShake #PremierProtein #NonDairy #TargetPartner Target

Comment SHOP below to receive a DM with the link to this post on my LTK ⬇ https://liketk.it/5XPAI ltkdayinmylife ltkfitnessgoals ltkactive
Want to get your kids to talk more? We love these Want to get your kids to talk more? We love these cards! 

We have them at the dinner table every time and they make it SO much fun. 

Insights into their lives
Fun challenges
More deep thinking 

Perfect for screen free restaurant time as well! Lily can’t read yet so we just whisper her the question, but she loves the challenges in Do you really know my family! 

Comment ‘Cards’ below and I’ll send the link right to your inbox!
These are the kind of protein bars I actually keep These are the kind of protein bars I actually keep in my fridge. (AD) 

& they were inspired by my most asked question! “What protein bars do you like?”

These bars are…

✔️ fudgy
✔️ naturally sweetened
✔️ high-fiber
✔️ made with NOW Sports chocolate whey

No weird fillers. No chalky aftertaste. Just protein + fiber + flavor that actually keeps you full — and fits real life.

I dropped the full recipe + easy macro swaps in a doc so you can “Taylor” it to your goals

COMMENT “BARS” BELOW 
and I’ll send you the link to this recipe + my discount code for @nowfoodsofficial

#NowPartner #NOWWellness #TaylordTable
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Newsletter form goes here
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Sign up for our newsletter and get...

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle.
Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle. Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

ALL RIGHTS RESERVED TWF 2026 | DESIGNED BY PAPER+SCREEN
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact