ImageImage
ImageImage
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact

Curry Shrimp With Snap Peas

Don’t know what to cook?  I have a quick and delicious meal just for you. Cook right along with me in my kitchen today! Curry Shrimp and Snap peas are on the menu. Everything you need to know about this recipe is posted below. Ingredients: 2 Tbs. Organic Coconut Oil 2 Tbs. Curry Powder 1-2 Dozen Shrimp (peeled and deveined) …

Read More
budgetfriendlymealscurryrecipescurryshrimpfitnessmealshealthydinnerhealthymealsquickmealsshrimpweeknightdinner

Taylor Walker

The Enlite Bra: HIIT Tested. Taylor Approved.

Taylor is a Certified Personal Trainer, Barre Instructor, Spartan SGX and Nutrition Coach. Taylor has been featured in ads for major brands such as: Nike, Under Armour, FILA, Champion USA, Belk, Beall's, Kohl's, Atlantis Resort, Babies "R" Us, Zappos & more! You can find her gracing the pages of Fitness, Shape and Women's Health Magazine.

Subscribe

Follow me on Pinterest!

@TaylorWalkerFit

Instagram did not return a 200.

Follow Me!

High-Protein Creamy Oats ~32–40g protein dependin High-Protein Creamy Oats

~32–40g protein depending on amount of egg whites + Protein.

Ingredients:

3/4 cup Trader Joe’s Oat & Seed Blend
1 Serving  of Protein Powder @kachava 
1 cup water (or more for thinner oats)
¼-1/2 C cup liquid egg whites (Not oats lol)
Optional: cinnamon, berries, banana slices, nut butter, hemp hearts, pumpkin seeds, maple syrup

Instructions:
Combine water and egg whites then add oats and bring to simmer. Stir in protein powder until oats are cooked all the way through. Add to a bowl and top with your favorite fixin’s! 

Add anything you love:

Berries for antioxidants
Almond butter for healthy fats
Cinnamon for blood sugar balance
Hemp hearts or chia for extra protein/fiber
Pumpkin Seeds
One from the October Drafts. Tell me, how did kids One from the October Drafts. Tell me, how did kids change your life, marriage etc? #marriage 

PS…if you make it to the end of this video, the dress I am wearing is on sale for $69. I paid over $200. Comment DRESS below and I’ll send you details.
3 items I have in my 4 year olds room that we can’ 3 items I have in my 4 year olds room that we can’t live without! 

Comment SHOP below to receive a DM with the link to this post on my LTK ⬇ https://liketk.it/5CQuf #ltkgiftguide #ltkholiday
Look at YOU. Doing it…even when it’s hard. You g Look at YOU. Doing it…even when it’s hard. 

You guys got a mini glimpse into a 5:30 AM wake up for myself which turned into a 5:40 tantrum. We stayed the course. She was frustrated, clingy and became my 45 LB weight. 

Life never fails to throw curveballs, but consistency matters. What they see you do day in and day out matters. 

I simply kept saying: I will not give up on myself. I love having you here. Hop on. Try this with me. And finally, she did. 

So if you’re in a season of motherhood that feels impossible…I get it. I’ve been there, but stay the course. It all gets better. Would you want a holiday series of #Taylord20 workouts you can  do anytime anywhere? 

I did this over the holidays last year and absolutely loved it!
Anyone else?! #momlifebelike Anyone else?! #momlifebelike
My workouts have become non-negotiable. If I’m w My workouts have become non-negotiable. 

If I’m working out from home…here’s how I set boundaries with my stage 5 clinger of a boo thing when she’s in a mood. 

Comfort + connection (offer hugs and closeness)
Calm Tone (even when they’re not)
Compassion (validate their feelings, but be firm yet warm)
Choice Based (give them choice on where they want to stay)
Consequences (Age appropriate. If she didn’t stop taking off my weight clips, she would have ended up in a different room)

I accidentally caught this during my AM workout and so many of you related in stories. Staying consistent isn’t easy, but I hope this helps! If there’s something you do that works, please let me know! #fitmom
& we all call him daddy. 😂 #husband & we all call him daddy. 😂 #husband
Updating the family portrait with SIX kids under e Updating the family portrait with SIX kids under eight, sibling wrestling matches and leftover sandwiches. Thankful for the chaos. #familytime❤️ #Holidays
A gem from the drafts. I just love normalizing b A gem from the drafts. 

I just love normalizing big conversations with her. If she could go back in my belly every day she would. Is this a second born thing or a daughter thing? 🤣😂🥰#hypnobirthing #childbirth #motherhood
Well New Jersey…that was rude. Mexico in November… Well New Jersey…that was rude. Mexico in November….chefs kiss.  #momswholift #puertavallarta
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Newsletter form goes here
Image
Facebook
Instagram
Twitter
Pinterest
Bloglovin
YouTube
About
Podcast
Blog
Contact

Stay in touch


Sign up for our newsletter and get...

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle.
Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

It’s about infusing your world with health and wellness practices that FIT your world and support your hustle. Consider this your balanced lifestyle solution and join The Wellness Freaks Collective.

ALL RIGHTS RESERVED TWF 2025 | DESIGNED BY PAPER+SCREEN
  • About TWF
  • Blog
    • Sweat
    • Nourish
    • Nurture
    • Live
  • Classes
  • Your Empowered Birth
  • HypnoBirthing
  • Press
  • Contact